PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30076.m004651
Common NameRCOM_1347110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 642aa    MW: 73135.4 Da    PI: 6.7617
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30076.m004651genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS274.72.9e-842596271374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl.fsevsPilkf 93 
                    l +lLl++Ae v  +++ +a++lL+r + +as++++p+qR++ +f+eAL++r+ +    + + +p ++t++++    ++l+  +l f++  P+ ++
  30076.m004651 259 LAHLLLAAAEKVGYQQFDRASRLLSRCEWIASQRANPVQRVVYCFAEALRERIDK---ATGRFIPKERTESYDipDGTSLHLACLsFHQNVPLNQI 351
                    579***************************************************9...6666677777777775534444444447********** PP

           GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                    ++lt  qaI+e + +++++ +iD++i  G+QW a++qaLa+R+ ++  +l++T++g   +g+ +++eetg+ L++fA+++++pf f++++++ +++
  30076.m004651 352 TQLTSIQAIMENIGSARKLQVIDLEIRSGVQWTAMMQALAERQqRPLEHLKVTALGL--TGKGKKIEETGRSLESFAKSMNIPFTFKAVYVSCMKN 445
                    *******************************************45556*********..679********************************** PP

           GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                    ++ + +++  +E+l+V + + l +l +++ +le+    +++++k+l+P ++v+ e ea+hns++F++rf+eal +ysa fd+le+ l +++e+++ 
  30076.m004651 446 IKEKLFEIAADESLVVVSNMFLRTLISSPECLEN----LMRVIKNLKPSIMVINEIEANHNSPNFVNRFIEALFFYSAYFDCLETCLDHNNEHKSI 537
                    **************************99999999....*************************************************999999999 PP

           GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +E+   +r i++ va+  +er+ r+ +   Wr+ ++++ + ++ +se+a  qa+l+ ++++ +   +++++ ++l+ gWk+ pL s+SaW+
  30076.m004651 538 IEAL-YSRGIRETVAMGDNERISRNVKIDVWRAFFSRFRMVEIGFSESALYQASLVCKQFAcGSSCSLDKNGKCLIVGWKGTPLHSLSAWK 627
                    9987.9*******************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.308233606IPR005202Transcription factor GRAS
PfamPF035141.0E-81259627IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MASLKRHRRY QDPCYLYTSE FSTIDICVYV NWTTILSHLR VNSPISFCWE MANGSYSFTP  60
FDFSGIQGDY SPLDQQYYEK EGAKMKEKQD PLFSMEELGG VYPLCSEYGA CQDDTANKGL  120
QYVFRDQEEP QPQPLKSTCL TSDECVGTCF PAPAQAMQEV KNYENVPKSS KELSHPFTLS  180
SSLELLNNYG SGFKRLNLNQ VNNASNSQTK LSTEEIMRVA GARYIQFSDQ RYDDFSMLMH  240
PFGYALSGLS EEETRDVELA HLLLAAAEKV GYQQFDRASR LLSRCEWIAS QRANPVQRVV  300
YCFAEALRER IDKATGRFIP KERTESYDIP DGTSLHLACL SFHQNVPLNQ ITQLTSIQAI  360
MENIGSARKL QVIDLEIRSG VQWTAMMQAL AERQQRPLEH LKVTALGLTG KGKKIEETGR  420
SLESFAKSMN IPFTFKAVYV SCMKNIKEKL FEIAADESLV VVSNMFLRTL ISSPECLENL  480
MRVIKNLKPS IMVINEIEAN HNSPNFVNRF IEALFFYSAY FDCLETCLDH NNEHKSIIEA  540
LYSRGIRETV AMGDNERISR NVKIDVWRAF FSRFRMVEIG FSESALYQAS LVCKQFACGS  600
SCSLDKNGKC LIVGWKGTPL HSLSAWKFCG DRLGRFFPNY RF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2928962733375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572330.10.0PREDICTED: DELLA protein RGL1
TrEMBLB9RND90.0B9RND9_RICCO; DELLA protein RGL2, putative
STRINGPOPTR_0014s11510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.18e-52RGA-like 2